PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011088451.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 656aa    MW: 72287.8 Da    PI: 5.1279
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011088451.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-094194561954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  XP_011088451.1 419 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 456
                     664459******************************88 PP

2BELL127.16.3e-41281352172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqelq+k++kLls+l+eVd+rY+qy++q+q+++ssF+ vag g+akpYt+lAl++iSrhFrcL+dai +qi
  XP_011088451.1 281 ERQELQNKITKLLSMLDEVDRRYRQYYHQMQIIVSSFDLVAGSGAAKPYTALALQTISRHFRCLRDAINGQI 352
                     79********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.8E-60201350IPR006563POX domain
PfamPF075268.5E-52207348IPR006563POX domain
PROSITE profilePS5007112.195397460IPR001356Homeobox domain
SMARTSM003891.6E-9400464IPR001356Homeobox domain
CDDcd000867.21E-13400461No hitNo description
SuperFamilySSF466892.05E-17401467IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28403466IPR009057Homeodomain-like
PfamPF059204.4E-18417456IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 656 aa     Download sequence    Send to blast
MGMYFPMPNN QIQRDAATML YLREPLPSSH SETPVLPGNT MYMNFPSSSG PYSDALAGNS  60
QSVNVQPVAS DSNTSQQELL LQFGGSRAVE NQLMHRQGES SDILQGAPNL QGQGLSLSLS  120
TNVPSVMQIS PTQYQNNNPV FSSILGPNTL MPGEDSGRNI SFGNEDNFQT KPPGENRNCM  180
VSHVSGINSD GTNDISTYGM PSIARAVPNS KYLKAAQQLL DEIVNVKKAI KEQNAKKELM  240
KESKEVEGEF GDGASDPSAA AASSVPPKPI GNPQNELSVA ERQELQNKIT KLLSMLDEVD  300
RRYRQYYHQM QIIVSSFDLV AGSGAAKPYT ALALQTISRH FRCLRDAING QILVARKNLG  360
EEDASSNDKG VGISRLRYVD QQLRQQRALQ QLGMIQQHSW RPQRGLPETS VSILRAWLFE  420
HFLHPYPKDS DKIMLARQTG LTRSQVSNWF INARVRLWKP MVEEMYKEEI GDADIDSNSS  480
SETIPRAAKT GRKASEDKGE DVHQTATSTG RLMESKSDQM TDVQMIGSDT YSIYQNMIPA  540
EPQIDYGVGK TREGLKQTND SNPFPDSMVD PDCGNDSRML AAYQMSELER FGNVSGVSLT  600
LGLQQCEGNR GFVPLRDTDV YNTAASAMGN ETAEFDCIDS GNRPHQLVSS LLPSFT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B2e-16406464563Homeobox protein Meis2
3k2a_A2e-16406464563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088451.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLA0A061DZU50.0A0A061DZU5_THECC; BEL1-like homeodomain protein 6 isoform 1
STRINGVIT_03s0038g00050.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA102052226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-125BEL1-like homeodomain 7